ATG7 Fragment MS Protein Standard

Ubiquitin-like modifier-activating enzyme ATG7

ATG7 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ATG7 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ATG7

ATG12-activating enzyme E1 ATG7, Autophagy-related protein 7, Ubiquitin-activating enzyme E1-like protein

O95352

EAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNK