ATOH7 Fragment MS Protein Standard

Protein atonal homolog 7

ATOH7 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ATOH7 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ATOH7

Class A basic helix-loop-helix protein 13, Helix-loop-helix protein hATH-5

Q8N100

RILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT