ATP10D Fragment MS Protein Standard

Probable phospholipid-transporting ATPase VD

ATP10D Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ATP10D protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ATP10D

ATPase class V type 10D, P4-ATPase flippase complex alpha subunit ATP10D

Q9P241

LFPSPILRAKHFDRLTPEERTKALKKWRGAGKMNQVTSKYANQSAGKSGRRPMPGPSAVFAMKSASSCAIEQGNLSLCETALDQGYSETKAFEMAGPS