ATP1B4 Fragment MS Protein Standard

Protein ATP1B4

ATP1B4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ATP1B4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ATP1B4

X,K-ATPase subunit beta-m, X/potassium-transporting ATPase subunit beta-m

Q9UN42

LLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSISYYPESASFDLRYYPYYG