ATP6V1B2 Fragment MS Protein Standard

V-type proton ATPase subunit B, brain isoform

ATP6V1B2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ATP6V1B2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ATP6V1B2

Endomembrane proton pump 58 kDa subunit, HO57, Vacuolar proton pump subunit B 2

P21281

MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLE