ATP8B2 Fragment MS Protein Standard

Phospholipid-transporting ATPase ID

ATP8B2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ATP8B2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ATP8B2

ATPase class I type 8B member 2, P4-ATPase flippase complex alpha subunit ATP8B2

P98198

LVLAYKDLDEEYYEEWAERRLQASLAQDSREDRLASIYEEVENNMML