AVPR1A Fragment MS Protein Standard

Vasopressin V1a receptor

AVPR1A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AVPR1A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

AVPR1A

AVPR V1a, Antidiuretic hormone receptor 1a, Vascular/hepatic-type arginine vasopressin receptor

P37288

NIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAK