B3GNT2 Fragment MS Protein Standard

Product Information
Protein Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
Description
B3GNT2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human B3GNT2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
B3GNT2
Synonyms
Beta-1,3-N-acetylglucosaminyltransferase 1, Beta-1,3-galactosyltransferase 7, Beta-3-Gx-T7, UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 7, UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 7
Uniprot ID
Q9NY97
Product Sequence
DTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
2
Inquiry Basket