B3GNT3 Fragment MS Protein Standard

UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3

B3GNT3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human B3GNT3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

B3GNT3

Beta-1,3-galactosyltransferase 8, Beta-3-Gx-T8, Core 1 extending beta-1,3-N-acetylglucosaminyltransferase, Core1-beta3GlcNAcT, Transmembrane protein 3, UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8, UDP-galactose:beta-N-acetylglucosamine beta-1,3-g

Q9Y2A9

LLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETR