BAIAP2 Fragment MS Protein Standard

Brain-specific angiogenesis inhibitor 1-associated protein 2

BAIAP2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human BAIAP2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

BAIAP2

Fas ligand-associated factor 3, Insulin receptor substrate p53/p58, Insulin receptor substrate protein of 53 kDa

Q9UQB8

AYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQE