BANF1 Full-Length MS Protein Standard

Product Information
Protein Name
barrier to autointegration factor 1
Description
BANF1 Full-Length MS Protein Standard (NP_003851), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein.
Symbol
BANF1
Synonyms
BAF; BCRP1; D14S1460; NGPS
Accession
NM_003860
Cytogenetic
11q13.1
Amino Acid Labeled
[U- 13C6, 15N4]-L-Arg and [U- 13C6, 15N2]-L-Lys
Chemical Purity
> 80% as determined by SDS-PAGE and Coomassie blue staining
Expression Host
Human HEK293 cells
Predicted MW
9.9 kDa
Expression True or False Clone
RC203270
Protein Sequence
>RC203270 representing NM_003860
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGAN
AKQSRDCFGCLREWCDAFL

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2026 Creative Proteomics. All rights reserved.
2
Inquiry Basket