BCL6B Fragment MS Protein Standard

B-cell CLL/lymphoma 6 member B protein

BCL6B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human BCL6B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

BCL6B

Bcl6-associated zinc finger protein, Zinc finger protein 62

Q8N143

RLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEFFSCQNCEAVAGCSSGLDSLVPGDED