BHLHA15 Fragment MS Protein Standard

Class A basic helix-loop-helix protein 15

BHLHA15 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human BHLHA15 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

BHLHA15

Class B basic helix-loop-helix protein 8, Muscle, intestine and stomach expression 1

Q7RTS1

AKNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREG