BHLHE22 Fragment MS Protein Standard

Class E basic helix-loop-helix protein 22

BHLHE22 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human BHLHE22 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

BHLHE22

Class B basic helix-loop-helix protein 5, Trinucleotide repeat-containing gene 20 protein

Q8NFJ8

GLLVGSAGVGGDPSLSSLPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGV