BNIP1 Fragment MS Protein Standard

Vesicle transport protein SEC20

BNIP1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human BNIP1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

BNIP1

BCL2/adenovirus E1B 19 kDa protein-interacting protein 1, Transformation-related gene 8 protein

Q12981

QRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTI