BPIFA3 Fragment MS Protein Standard

BPI fold-containing family A member 3

BPIFA3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human BPIFA3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

BPIFA3

Short palate, lung and nasal epithelium carcinoma-associated protein 3

Q9BQP9

QPWPGLAQAHRDNKSTLARIIAQGLIKHNAESRIQNIHFGDRLNASAQVAPGLVGWLISGR