BTK Fragment MS Protein Standard

Tyrosine-protein kinase BTK

BTK Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human BTK protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

BTK

Agammaglobulinemia tyrosine kinase, B-cell progenitor kinase, Bruton tyrosine kinase

Q06187

CVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQIL