C19orf57 Fragment MS Protein Standard

Uncharacterized protein C19orf57

C19orf57 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human C19orf57 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

C19orf57

Pre-T/NK cell-associated protein 3B3

Q0VDD7

DPTELEERALEVAGPDGQASAISPASPRRKAADGGHRRALPGCTSLTGETTGESGEAGQDGKPPGDVLVGPTASLALAPGSGESMMGAGDSGHASPD