C1GALT1C1 Fragment MS Protein Standard

C1GALT1-specific chaperone 1

C1GALT1C1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human C1GALT1C1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

C1GALT1C1

C38H2-like protein 1, Core 1 beta1,3-galactosyltransferase 2, Core 1 beta3-galactosyltransferase-specific molecular chaperone

Q96EU7

NRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIE