C1QBP Fragment MS Protein Standard

Complement component 1 Q subcomponent-binding protein, mitochondrial

C1QBP Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human C1QBP protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

C1QBP

ASF/SF2-associated protein p32, Glycoprotein gC1qBP, Hyaluronan-binding protein 1, Mitochondrial matrix protein p32, gC1q-R protein, p33

Q07021

GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY