C6orf165 Fragment MS Protein Standard

UPF0704 protein C6orf165

C6orf165 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human C6orf165 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

C6orf165

Q8IYR0

ELGTFLTLSKKDKERQLKELTMIVTGIRLFNRDCGKGGEGIDDLPAVLHVAIPATMQHIDYQLETARSQVYRYTAILEKAANDPLMRAELQPYMLK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!