CACNA1B Fragment MS Protein Standard

Voltage-dependent N-type calcium channel subunit alpha-1B

CACNA1B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CACNA1B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CACNA1B

Brain calcium channel III, Calcium channel, L type, alpha-1 polypeptide isoform 5, Voltage-gated calcium channel subunit alpha Cav2.2

Q00975

ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE