CALCOCO2 Fragment MS Protein Standard

Calcium-binding and coiled-coil domain-containing protein 2

CALCOCO2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CALCOCO2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CALCOCO2

Antigen nuclear dot 52 kDa protein, Nuclear domain 10 protein NDP52, Nuclear dot protein 52

Q13137

YYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSD