CAMK1D Fragment MS Protein Standard

Calcium/calmodulin-dependent protein kinase type 1D

CAMK1D Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CAMK1D protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CAMK1D

CaM kinase I delta, CaMKI-like protein kinase

Q8IU85

MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGG