CARKD Fragment MS Protein Standard

ATP-dependent (S)-NAD(P)H-hydrate dehydratase

CARKD Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CARKD protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CARKD

ATP-dependent NAD(P)HX dehydratase, Carbohydrate kinase domain-containing protein

Q8IW45

PNAVHEVEKWLPRLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPALIHGYRKAVLTPNHVEFSRLYDAVLR