CC2D1A Fragment MS Protein Standard

Coiled-coil and C2 domain-containing protein 1A

CC2D1A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CC2D1A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CC2D1A

Akt kinase-interacting protein 1, Five prime repressor element under dual repression-binding protein 1, Putative NF-kappa-B-activating protein 023N

Q6P1N0

NLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDTTAAAR