CD22 Fragment MS Protein Standard

B-cell receptor CD22

CD22 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CD22 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CD22

B-lymphocyte cell adhesion molecule, Sialic acid-binding Ig-like lectin 2, T-cell surface antigen Leu-14

P20273

DLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLL