CD300LB Fragment MS Protein Standard

Product Information
Protein Name
CMRF35-like molecule 7
Description
CD300LB Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CD300LB protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
CD300LB
Synonyms
CD300 antigen-like family member B, CMRF35-A2, Immune receptor expressed on myeloid cells 3, Leukocyte mono-Ig-like receptor 5, Triggering receptor expressed on myeloid cells 5
Uniprot ID
A8K4G0
Product Sequence
YWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNH

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2025 Creative Proteomics. All rights reserved.
0
Inquiry Basket

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

Accept Cookies
x