CDC14B Fragment MS Protein Standard

Dual specificity protein phosphatase CDC14B

CDC14B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CDC14B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CDC14B

CDC14 cell division cycle 14 homolog B

O60729

RCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHY