CDC5L Fragment MS Protein Standard

Cell division cycle 5-like protein

CDC5L Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CDC5L protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CDC5L

Pombe cdc5-related protein

Q99459

DLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHM