CDCA2 Fragment MS Protein Standard

Product Information
Protein Name
Cell division cycle-associated protein 2
Description
CDCA2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CDCA2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
CDCA2
Synonyms
Recruits PP1 onto mitotic chromatin at anaphase protein
Uniprot ID
Q69YH5
Product Sequence
IKCERKDDFLGAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGRSLHLEKNGNHTPSS

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2026 Creative Proteomics. All rights reserved.
2
Inquiry Basket