CDCA4 Fragment MS Protein Standard

Cell division cycle-associated protein 4

CDCA4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CDCA4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CDCA4

Hematopoietic progenitor protein

Q9BXL8

LKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDR