CDK12 Fragment MS Protein Standard

Cyclin-dependent kinase 12

CDK12 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CDK12 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CDK12

Cdc2-related kinase, arginine/serine-rich, Cell division cycle 2-related protein kinase 7, Cell division protein kinase 12

Q9NYV4

KESKGSPVFLPRKENSSVEAKDSGLESKKLPRSVKLEKSAPDTELVNVTHLNTEVKNSSDTGKVKLDENSEKHLVKDLKAQ