CDKN2C Fragment MS Protein Standard

Product Information
Protein Name
Cyclin-dependent kinase 4 inhibitor C
Description
CDKN2C Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CDKN2C protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
CDKN2C
Synonyms
Cyclin-dependent kinase 6 inhibitor, p18-INK4c, p18-INK6
Uniprot ID
P42773
Product Sequence
LQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2026 Creative Proteomics. All rights reserved.
2
Inquiry Basket