CHTOP Fragment MS Protein Standard

Chromatin target of PRMT1 protein

CHTOP Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CHTOP protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CHTOP

Friend of PRMT1 protein, Small arginine- and glycine-rich protein

Q9Y3Y2

MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQSLKQRLGKSNIQARLGRPIG