CIDEC Fragment MS Protein Standard

Cell death activator CIDE-3

CIDEC Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CIDEC protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CIDEC

Cell death-inducing DFFA-like effector protein C, Fat-specific protein FSP27 homolog

Q96AQ7

MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLK