CLASP1 Fragment MS Protein Standard

CLIP-associating protein 1

CLASP1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CLASP1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CLASP1

Cytoplasmic linker-associated protein 1, Multiple asters homolog 1, Protein Orbit homolog 1

Q7Z460

TSPTNCSHGGLSPSRLWGWSADGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDT