CRACR2A Fragment MS Protein Standard

EF-hand calcium-binding domain-containing protein 4B

CRACR2A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CRACR2A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CRACR2A

Calcium release-activated calcium channel regulator 2A, Calcium release-activated channel regulator 2A

Q9BSW2

KEEPHLLSNFEDFLTRIISQLQEAHEEKNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLKDTERFQARSQELEQKLLCK