CRISPLD1 Fragment MS Protein Standard

Cysteine-rich secretory protein LCCL domain-containing 1

CRISPLD1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CRISPLD1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CRISPLD1

CocoaCrisp, Cysteine-rich secretory protein 10, LCCL domain-containing cysteine-rich secretory protein 1, Trypsin inhibitor Hl

Q9H336

ACPPSFGGGCRENLCYKEGSDRYYPPREEETNEIERQQSQVHDTHVRTRSDDSSRNEVISAQQMSQIVSCEVRLRDQCKGTTCNRYECPAGC