CSF2RA Fragment MS Protein Standard

Granulocyte-macrophage colony-stimulating factor receptor subunit alpha

CSF2RA Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CSF2RA protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CSF2RA

CDw116

P15509

VAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTW