CYP2E1 Fragment MS Protein Standard

Cytochrome P450 2E1

CYP2E1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CYP2E1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CYP2E1

4-nitrophenol 2-hydroxylase, CYPIIE1, Cytochrome P450-J

P05181

PCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLIL