DDX20 Fragment MS Protein Standard

Probable ATP-dependent RNA helicase DDX20

DDX20 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DDX20 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

DDX20

Component of gems 3, DEAD box protein 20, DEAD box protein DP 103, Gemin-3

Q9UHI6

MAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEENMMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVK