DDX42 Fragment MS Protein Standard

ATP-dependent RNA helicase DDX42

DDX42 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DDX42 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

DDX42

DEAD box protein 42, RNA helicase-like protein, RNA helicase-related protein, SF3b DEAD box protein, Splicing factor 3B-associated 125 kDa protein

Q86XP3

TAGVVQEEEEDNLEYDSDGNPIAPTKKIIDPLPPIDHSEIDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLNLRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQG