DDX43 Fragment MS Protein Standard

Probable ATP-dependent RNA helicase DDX43

DDX43 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DDX43 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

DDX43

Cancer/testis antigen 13, DEAD box protein 43, DEAD box protein HAGE, Helical antigen

Q9NXZ2

GIDTAFQPSVGKDGSTDNNVVAGDRPLIDWDQIREEGLKWQKTKWADLPPIKKNFYKESTATSAMSKVEADSWR