DEFB112 Fragment MS Protein Standard

Beta-defensin 112

DEFB112 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DEFB112 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

DEFB112

Beta-defensin 12, Defensin, beta 112

Q30KQ8

MKLLTTICRLKLEKMYSKTNTSSTIFEKARHGTEKISTARSEGHHITFSRWKSCT