DNAJC14 Fragment MS Protein Standard

DnaJ homolog subfamily C member 14

DNAJC14 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DNAJC14 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

DNAJC14

DnaJ protein homolog 3, Dopamine receptor-interacting protein of 78 kDa, Human DnaJ protein 3

Q6Y2X3

HRRFEMDREPKSARYCAECNRLHPAEEGDFWAESSMLGLKITYFALMDGKVYDITEWAGCQRVGISPDTHRVPYHISFGSR