DNM1L Fragment MS Protein Standard

Product Information
Protein Name
Dynamin-1-like protein
Description
DNM1L Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DNM1L protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
DNM1L
Synonyms
Dnm1p/Vps1p-like protein, Dynamin family member proline-rich carboxyl-terminal domain less, Dynamin-like protein, Dynamin-like protein 4, Dynamin-like protein IV, Dynamin-related protein 1
Uniprot ID
O00429
Product Sequence
YCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKR

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2025 Creative Proteomics. All rights reserved.
2
Inquiry Basket