DPH5 Fragment MS Protein Standard

Diphthine synthase

DPH5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DPH5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

DPH5

Diphthamide biosynthesis methyltransferase

Q9H2P9

VLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMS