DPM1 Fragment MS Protein Standard

Product Information
Protein Name
Dolichol-phosphate mannosyltransferase subunit 1
Description
DPM1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DPM1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
DPM1
Synonyms
Dolichol-phosphate mannose synthase subunit 1, Dolichyl-phosphate beta-D-mannosyltransferase subunit 1, Mannose-P-dolichol synthase subunit 1
Uniprot ID
O60762
Product Sequence
SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2025 Creative Proteomics. All rights reserved.
0
Inquiry Basket

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

Accept Cookies
x