DYNLL1 Fragment MS Protein Standard

Dynein light chain 1, cytoplasmic

DYNLL1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DYNLL1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

DYNLL1

8 kDa dynein light chain, Dynein light chain LC8-type 1, Protein inhibitor of neuronal nitric oxide synthase

P63167

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIV